PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4U28891.10
Common NameJCGZ_22555, LOC105646109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 40aa    MW: 4669.51 Da    PI: 9.9665
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4U28891.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like55.99.4e-182312655
        G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   +AtPk +l+lm+v++Lt++hvkSHLQkYR+
  Jcr4U28891.10  2 EATPKGVLKLMNVESLTIYHVKSHLQKYRI 31
                   69***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.2E-12232IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.2E-16232IPR009057Homeodomain-like
SuperFamilySSF466894.3E-8331IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 40 aa     Download sequence    Send to blast
VEATPKGVLK LMNVESLTIY HVKSHLQKYR IAKYLPENKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087265.12e-18PREDICTED: protein PHR1-LIKE 1
RefseqXP_012087266.12e-18PREDICTED: protein PHR1-LIKE 1
RefseqXP_012087267.12e-18PREDICTED: protein PHR1-LIKE 1
RefseqXP_012087268.12e-18PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A067JYD52e-18A0A067JYD5_JATCU; Uncharacterized protein
STRINGGSMUA_Achr10P23260_0017e-16(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-17G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]